Химическая формула белка


белки — урок. Биология, Общие биологические закономерности (9–11 класс).

Белки (протеины, полипептиды) — самые многочисленные, наиболее разнообразные и имеющие первостепенное значение биополимеры. В состав молекул белков входят атомы углерода, кислорода, водорода, азота и иногда серы, фосфора и железа.

Мономерами белков являются аминокислоты, которые (имея в своём составе карбоксильную и аминогруппы) обладают свойствами кислоты и основания (амфотерны).

Благодаря этому аминокислоты могут соединяться друг с другом (их количество в одной молекуле может достигать нескольких сотен). В связи с этим молекулы белков имеют большие размеры, и их называют макромолекулами.

Структура белковой молекулы

Под структурой белковой молекулы понимают её аминокислотный состав, последовательность мономеров и степень скрученности молекулы белка.

В молекулах белков встречается всего \(20\) видов различных аминокислот, и огромное разнообразие белков создаётся за счёт различного их сочетания.

  • Последовательность аминокислот в составе полипептидной цепи — это первичная структура белка (она уникальна для любого белка и определяет его форму, свойства и функции). Первичная структура белка уникальна для любого типа белка и определяет форму его молекулы, его свойства и функции.
  • Длинная молекула белка сворачивается и приобретает сначала вид спирали в результате образования водородных связей между —СО и —NН группами разных аминокислотных остатков полипептидной цепи (между углеродом карбоксильной группы одной аминокислоты и азотом аминогруппы другой аминокислоты). Эта спираль — вторичная структура белка.
  • Третичная структура белка — трёхмерная пространственная «упаковка» полипептидной цепи в виде глобулы (шарика). Прочность третичной структуры обеспечивается разнообразными связями, возникающими между радикалами аминокислот (гидрофобными, водородными, ионными и дисульфидными S–S связями).
  • Некоторые белки (например, гемоглобин крови человека) имеют четвертичную структуру. Она возникает в результате соединения нескольких макромолекул с третичной структурой в сложный комплекс. Четвертичная структура удерживается непрочными ионными, водородными и гидрофобными связями.

 

Структура белков может нарушаться (подвергаться денатурации) при нагревании, обработке некоторыми химическими веществами, облучении и др. При слабом воздействии распадается только четвертичная структура, при более сильном — третичная, а затем — вторичная, и белок остаётся в виде полипептидной цепи. В результате денатурации белок теряет способность выполнять свою функцию.

Нарушение четвертичной, третичной и вторичной структур обратимо. Этот процесс называют ренатурацией.

 

Разрушение первичной структуры необратимо.

 

Кроме простых белков, состоящих только из аминокислот, есть ещё и сложные белки, в состав которых могут входить углеводы (гликопротеины), жиры (липопротеины), нуклеиновые кислоты (нуклеопротеины) и др.

Функции белков

  • Каталитическая (ферментативная) функция. Специальные белки — ферменты — способны ускорять биохимические реакции в клетке в десятки и сотни миллионов раз. Каждый фермент ускоряет одну и только одну реакцию. В состав ферментов входят витамины.
  • Структурная (строительная) функция — одна из основных функций белков (белки входят в состав клеточных мембран; белок кератин образует волосы и ногти; белки коллаген и эластин — хрящи и сухожилия).
  • Транспортная функция — белки обеспечивают активный транспорт ионов через клеточные мембраны (транспортные белки в наружной мембране клеток), транспорт кислорода и углекислого газа (гемоглобин крови и миоглобин в мышцах), транспорт жирных кислот (белки сыворотки крови способствуют переносу липидов и жирных кислот, различных биологически активных веществ).
  • Сигнальная функция. Приём сигналов из внешней среды и передача информации в клетку происходит за счёт встроенных в мембрану белков, способных изменять свою третичную структуру в ответ на действие факторов внешней среды.
  • Сократительная (двигательная) функция — обеспечивается сократительными белками — актином и миозином (благодаря сократительным белкам двигаются реснички и жгутики у простейших, перемещаются хромосомы при делении клетки, сокращаются мышцы у многоклеточных, совершенствуются другие виды движения у живых организмов).
  • Защитная функция — антитела обеспечивают иммунную защиту организма; фибриноген и фибрин защищают организм от кровопотерь, образуя тромб.
  • Регуляторная функция присуща белкам — гормонам (не все гормоны являются белками!). Они поддерживают постоянные концентрации веществ в крови и клетках, участвуют в росте, размножении и других жизненно важных процессах (например, инсулин регулирует содержание сахара в крови).
  • Энергетическая функция — при длительном голодании белки могут использоваться в качестве дополнительного источника энергии после того, как израсходованы углеводы и жиры (при полном расщеплении \(1\) г белка до конечных продуктов выделяется \(17,6\) кДж энергии). Аминокислоты, высвобождающиеся при расщеплении белковых молекул, используются для построения новых белков.

 

Источники:

Каменский А. А., Криксунов Е. А., Пасечник В. В. Биология. 9 класс // ДРОФА.
Каменский А. А., Криксунов Е. А., Пасечник В. В. Биология. Общая биология (базовый уровень) 10–11 класс // ДРОФА.

Лернер Г. И. Биология: Полный справочник для подготовки к ЕГЭ: АСТ, Астрель.

http://ours-nature.ru/lib/b/book/1063747118/348

Белки » HimEge.ru

Биологическое значение белков

Белки-это высокомолекулярные (молеку­лярная масса варьируется от 5-10 тыс. до 1 млн и более) природные полимеры, молекулы которых построены из остатков аминокислот, соединенных амидной (пептидной) связью.

Белки также называют протеинами (греч. «протос» — первый, важный). Число остатков амино­кислот в молекуле белка очень сильно колеблется и иногда достигает несколь­ких тысяч. Каждый белок об­ладает своей присущей ему последовательностью распо­ложения аминокислотных остатков.

Белки выполняют разнообразные биологичес­кие функции: каталитические (ферменты), регуля­торные (гормоны), структурные (коллаген, фибро­ин), двигательные (миозин), транспортные (гемоглобин, миоглобин), защитные (иммуноглобули­ны, интерферон), запасные (казеин, альбумин, глиадин) и другие.

Белки — основа биомембран, важнейшей состав­ной части клетки и клеточных компонентов. Они играют ключевую роль в жиз­ни клетки, составляя как бы материальную основу ее хи­мической деятельности.

Исключительное свойство белка — самоорганизация структуры, т. е. его способ­ность самопроизвольно соз­давать определенную, свой­ственную только данному белку пространственную структуру. По существу, вся деятельность организма (развитие, движение, выполнение им различных функций и многое дру­гое) связана с белковыми веществами. Без белков невозможно представить себе жизнь.

Белки — важнейшая составная часть пищи че­ловека и животных, поставщик необходимых ами­нокислот.

Строение белков

В пространственном строении белков большое значение имеет характер радикалов (остатков) R— в молекулах аминокислот. Неполярные радикалы аминокислот обычно располагаются внутри макро­молекулы белка и обусловливают гидрофобные взаимодействия; полярные радикалы, содержащие ионогенные (образующие ионы) группы, обычно находятся на поверхности макромолекулы белка и характеризуют электростатические (ионные) вза­имодействия. Полярные неионогенные радикалы (например, содержащие спиртовые ОН-группы, амидные группы) могут располагаться как на по­верхности, так и внутри белковой молекулы. Они участвуют в образовании водородных связей.

В молекулах белка α-аминокислоты связаны между собой пептидными (—СО—NH—) связями:

Построенные таким образом полипептидные це­пи или отдельные участки внутри полипептидной цепи могут быть в некото­рых случаях дополнительно связаны между собой дисульфидными (—S—S—) связями или, как их часто называют, дисульфидными мостиками.

Большую роль в создании структуры белков играют ион­ные (солевые) и водородные связи, а также гидрофобное взаимодействие — особый вид контактов между гидрофоб­ными компонентами молекул белков в водной среде. Все эти связи имеют различную прочность и обеспечивают образование сложной, большой молекулы белка.

Несмотря на различие в строении и функциях белковых веществ, их элементный состав колеб­лется незначительно (в % на сухую массу): угле­рода — 51-53; кислорода — 21,5-23,5; азота — 16,8-18,4; водорода — 6,5-7,3; серы — 0,3-2,5.

Некоторые белки содержат в небольших количе­ствах фосфор, селен и другие элементы.

Последовательность соединения аминокислот­ных остатков в полипептидной цепи получила на­звание первичной структуры белка.

Белковая молекула может состоять из одной или из нескольких полипептидных цепей, каж­дая из которых содержит различное число аминокис­лотных остатков. Учитывая число их возможных комби­наций, можно сказать, что разнообразие белков почти безгранично, но не все из них существуют в природе.

Общее число различных ти­пов белков у всех видов жи­вых организмов составляет 1011-1012. Для белков, строение которых отлича­ется исключительной сложностью, кроме первич­ной, различают и более высокие уровни структур­ной организации: вторичную, третичную, а иногда и четвертичную структуры.

Вторичной структурой обладает большая часть белков, правда, не всегда на всем протяжении полипептидной цепи. Полипептидные цепочки с определенной вторичной структурой могут быть по-разному расположены в пространстве.

В формировании третичной структуры, кроме водородных связей, большую роль играют ион­ное и гидрофобное взаимодействия. По характеру «упаковки» белковой молекулы различают глобу­лярные, или шаровидные, и фибриллярные, или нитевидные, белки (табл. 12).

Для глобулярных белков более характерна а-спиральная структура, спирали изогнуты, «свер­нуты». Макромолекула имеет сферическую форму. Они растворяются в воде и солевых растворах с об­разованием коллоидных систем. Большинство бел­ков животных, растений и микроорганизмов отно­сится к глобулярным белкам.

Для фибриллярных белков более характерна нитевидная структура. Они, как правило, не рас­творяются в воде. Фибриллярные белки обычно выполняют структурообразующие функции. Их свойства (прочность, способность растягиваться) за­висят от способа упаковки полипептидных цепо­чек. Примером фибриллярных белков служат мио­зин, кератин. В ряде случаев отдельные субъ­единицы белка с помощью во­дородных связей, электроста­тического и других взаимо­действий образуют сложные ансамбли. В этом случае об­разуется четвертичная струк­тура белков.

Примером белка с четвер­тичной структурой служит гемоглобин крови. Только с такой структурой он выполняет свои функции — связывание кислорода и транспортировка его в ткани и органы.

Однако следует отметить, что в организации бо­лее высоких структур белка исключительная роль принадлежит первичной структуре.

Классификация белков

Существует несколько классификаций белков:

  1. По степени сложности (простые и сложные).
  2. По форме молекул (глобулярные и фибрилляр­ные белки).
  3. По растворимости в отдельных растворителях (водорастворимые, растворимые в разбавлен­ных солевых растворах— альбумины, спирто­растворимые — проламины, растворимые в раз­бавленных щелочах и кислотах — глутелины).
  4. По выполняемым функциям (например, запас­ные белки, скелетные и т. п.).

Свойства белков

Белки — амфотерные электролиты. При опреде­ленном значении pH среды (оно называется изоэлектрической точкой) число положительных и от­рицательных зарядов в молекуле белка одинаково. Это одно из основных свойств белка. Белки в этой точке электронейтральны, а их растворимость в во­де наименьшая. Способность белков снижать рас­творимость при достижении электронейтральности их молекул используется для выделения из раство­ров, например, в технологии получения белковых продуктов.

Гидратация. Процесс гидратации означает свя­зывание белками воды, при этом они проявля­ют гидрофильные свойства: набухают, их масса и объ­ем увеличиваются. Набуха­ние отдельных белков за­висит исключительно от их строения. Имеющиеся в со­ставе и расположенные на поверхности белковой ма­кромолекулы гидрофильные амидные (—СО—NH—, пеп­тидная связь), аминные (—NH2) и карбоксильные (—СООН) группы притягивают к себе молекулы воды, строго ориентируя их на поверхности моле­кулы. Окружающая белковые глобулы гидратная (водная) оболочка препятствует агрегации и осаж­дению, а следовательно, способствует устойчиво­сти растворов белка. В изоэлектрической точке белки обладают наименьшей способностью свя­зывать воду, происходит разрушение гидратной оболочки вокруг белковых молекул, поэтому они соединяются, образуя крупные агрегаты. Агрега­ция белковых молекул происходит и при их обе­звоживании с помощью некоторых органических растворителей, например, этилового спирта. Это приводит к выпадению белков в осадок. При из­менении pH среды макромолекула белка стано­вится заряженной, и его гидратационная способ­ность меняется.

При ограниченном набухании концентрирован­ные белковые растворы образуют сложные систе­мы, называемые студнями.

Студни не текучи, упруги, обладают пластичностью, определенной механической прочностью, способны сохра­нять свою форму. Глобуляр­ные белки могут полностью гидратироваться, растворяться в воде (например, белки молока), образуя растворы с невысокой кон­центрацией. Гидрофильные свойства белков, т. е. их способность набухать, образовывать студни, стабилизировать суспензии, эмульсии и пены, имеют большое значение в биологии и пищевой промышленности. Очень подвижным студнем, по­строенным в основном из молекул белка, является цитоплазма — сырая клейковина, выделенная из пшеничного теста; она содержит до 65 % воды. Различная гидрофильность клейковинных бел­ков — один из признаков, характеризующих ка­чество зерна пшеницы и получаемой из него муки (так называемые сильные и слабые пшеницы). Ги­дрофильность белков зерна и муки играет боль­шую роль при хранении и переработке зерна, в хлебопечении. Тесто, которое получают в хлебо­пекарном производстве, представляет собой набух­ший в воде белок, концентрированный студень, содержащий зерна крахмала.

Денатурация белков. При денатурации под вли­янием внешних факторов (температуры, механиче­ского воздействия, действия химических агентов и ряда других факторов) происходит изменение вторичной, третич­ной и четвертичной структур белковой макромолекулы, т. е. ее нативной простран­ственной структуры. Первич­ная структура, а следователь­но, и химический состав белка не меняются. Изменяются физические свой­ства: снижается растворимость, способность к ги­дратации, теряется биологическая активность. Меняется форма белковой макромолекулы, проис­ходит агрегирование. В то же время увеличивает­ся активность некоторых химических групп, об­легчается воздействие на белки протеолитических ферментов, а следовательно, он легче гидролизу­ется.

В пищевой технологии особое практическое значение имеет тепловая денатурация белков, степень которой зависит от температуры, продол­жительности нагрева и влажности. Это необходи­мо помнить при разработке режимов термообра­ботки пищевого сырья, полуфабрикатов, а иногда и готовых продуктов. Особую роль процессы те­пловой денатурации играют при бланшировании растительного сырья, сушке зерна, выпечке хлеба, получении макаронных изделий. Денатура­ция белков может вызываться и механическим воздействием (давлением, растиранием, встряхи­ванием, ультразвуком). Наконец, к денатурации белков приводит действие химических реагентов (кислот, щелочей, спирта, ацетона). Все эти при­емы широко используются в пищевой и биотех­нологии.

Пенообразование. Под процессом пенообразования понимают способность белков образовывать высококонцентрированные системы «жидкость — газ», называемые пенами. Устой­чивость пены, в которой бе­лок является пенообразовате­лем, зависит не только от его природы и от концентрации, но и от температуры. Белки в качестве пенообразо­вателей широко используются в кондитерской про­мышленности (пастила, зефир, суфле). Структуру пены имеет хлеб, а это влияет на его вкусовые ка­чества.

Молекулы белков под влиянием ряда факторов могут разрушаться или вступать во взаимодействие с другими веществами с образованием новых про­дуктов. Для пищевой промышленности можно вы­делить два важных процесса:

1)      гидролиз белков под действием ферментов;

2)      взаимодействие аминогрупп белков или амино­кислот с карбонильными группами восстанавли­вающих сахаров.

Под влиянием ферментов протеаз, катализиру­ющих гидролитическое расщепление белков, по­следние распадаются на более простые продукты (поли- и дипептиды) и в конечном итоге на ами­нокислоты. Скорость гидролиза белка зависит от его состава, молекулярной структуры, активности фермента и условий.

Гидролиз белков. Реакцию гидролиза с образо­ванием аминокислот в общем виде можно записать так:

 

Горение. Белки горят с образованием азота, углекислого газа и воды, а также некоторых дру­гих веществ. Горение сопровождается характер­ным запахом жженых перьев.

Цветные реакции на белки. Для качественного определения белка используют следующие реакции:

1)  ксантопротеиновую, при которой происходит взаимодействие ароматических и гетероатомных циклов в молекуле белка с концентриро­ванной азотной кислотой, сопровождающееся появлением желтой окраски.

2)  биуретовую, при которой происходит взаимо­действие слабощелочных растворов белков с раствором сульфата меди (II) с образованием комплексных соединений между ионами Сu2+ и полипептидами. Реакция сопровождается по­явлением фиолетово-синей окраски.

Белки как молекулы. Состав, структура и функции белков

Белки выполняют ведущую роль в жизни организмов, преобладая в них и количественно. В теле животных они составляют 40-50% сухой массы, в растениях – 20-35%. Это самая разнообразная группа молекул – как химически, так и функционально. Состав и структура белков определяет огромное разнообразие их функций в клетке: их так много, что невозможно перечислить и описать их все. Однако можно сгруппировать эти функции в следующие восемь категорий. Но этот список также будет неполным.

    1. Ферментативная (каталитическая). Ферменты имеют белковое происхождение. Это трёхмерные глобулярные (свёрнутые) белки, плотно прилегающие к молекуле для её расщепления или сборки. Такая подгонка ускоряет специфические химические реакции в клетке.
    2. Защитная. Другие глобулярные белки используют свою форму для распознавания чужеродных микроорганизмов и раковых клеток. Эти приёмные устройства формируются эндокринной и иммунной системами. Многие живые организмы выделяют белки, ядовитые для других. Токсины синтезируют ряд животных, грибов, растений, микроорганизмов. В свою очередь, некоторые организмы способны вырабатывать антитоксины, которые подавляют действие этих ядов.
    3. Транспортная. Глобулярные белки присоединяют и транспортируют мелкие молекулы и ионы. Например, транспортный белок гемоглобин переносит кислород и углекислоту с потоком крови. Мембранные транспортные белки помогают молекулам и ионам двигаться через плазмалемму. Альбумины крови транспортируют жирные кислоты, глобулины – ионы металлов и гормоны.
    4. Структурная. Белковые молекулы входят в состав всех клеточных мембран и органоидов. Из белков построены элементы цитоскелета, сократительные структуры мышечных волокон. Структурными являются кератин в волосах, фибрин в сгустках крови, коллаген в коже, связках, сухожилиях и костях. В состав связок, стенок артерий и лёгких входит также структурный белок эластин.
    5. Двигательная. Сократительные белки обеспечивают способность клеток, тканей, органов и целых организмов изменять форму, двигаться. Мышцы сокращаются за счёт движения двух видов белковых нитей: актина и миозина. Контрактильные (лат. contraho, contractum – стягивать, сокращать) протеины играют ключевую роль в цитоскелете и передвижении веществ внутри клетки. Белок тубулин также входит в состав микротрубочек веретена деления, ресничек и жгутиков эукариотических клеток.
    6. Регуляторная. Крошечные белки, называемые гормонами, служат межклеточными посланниками в теле животных. Другие белки регулируют синтез РНК на ДНК, включая и выключая гены. Кроме того белки получают информацию, действуя в качестве рецепторов клеточной поверхности (эту функцию иногда считают отдельной, называя рецепторной).
    7. Запасающая. Кальций и железо хранятся в организме в виде ионов, связанных с белками хранения. В семенах растений запасаются резервные белки, которые используются зародышем при прорастании, а затем и проростком как источник азота.
  1. Энергетическая. После расщепления до аминокислот белки могут служить источником энергии в клетке. При полном окислении 1 г белка выделяется 17,6 кДж энергии. Однако белки расходуются на энергетические нужды лишь в крайних случаях, когда исчерпаны запасы углеводов и липидов.
Сравнительный размер молекул белков. Слева направо: антитело (IgG) (150 кДа), гемоглобин (66,8 кДа), гормон инсулин, фермент аденилаткиназа и фермент глютаминсинтетаза.
Автор: en:User:Gareth White, CC BY-SA 2.0

Функции белков

 

Функция Класс белка Образцы Примеры использования
Каталитическая Ферменты Карбогидразы Расщепляют полисахариды
Протеазы Разрушают белки
Полимеразы Синтезируют нуклеиновые кислоты
Киназы Фосфорилируют сахара и белки
Защитная Иммуноглобулины Антитела Маркируют чужеродные белки для элиминации (удаления)
Токсины Змеиный яд Блокирует нервные импульсы
Клеточные белки-антигены МНС-белки (главный комплекс гистосовместимости) Опознание чужеродных белков
Транспортная Циркуляционные транспортёры Гемоглобин Переносит кислород и углекислый газ крови
Миоглобин Переносит кислород и углекислый газ в скелетных мышцах и мышце сердца
Цитохромы Транспортируют электроны
Мембранные транспортные белки Натриево-калиевый насос Возбуждение мембраны
Протонный насос Хемиосмос
Транспортёр глюкозы Транспортирует глюкозу в клетки
Структурная Волокна Коллаген Образует хрящ
Кератин Формирует волосы, ногти, перья и др.
Фибрин Образует сгустки крови
Двигательная Мускулы Актин Сокращение мышечных волокон
Миозин Сокращение мышечных волокон
Регуляционная Осмотические белки Сывороточный альбумин Поддерживает осмотическую концентрацию крови
Регуляторы генов Репрессор Регулирует транскрипцию
Гормоны Инсулин Контролирует уровень глюкозы в крови
Вазопрессин Увеличивает задержку воды почками
Окситоцин Регулирует сокращение матки и выделение молока
Запасающая Ион-связывание Ферритин Хранит железо, особенно в селезёнке
Казеин Хранит ионы в молоке
Кальмодулин Связывает ионы кальция

Белки – это полимеры

Белки, или протеины – это нерегулярные (не имеющие определённой закономерности в последовательности мономеров) полимеры, состоящие из мономеров, называемые аминокислотами. Протеины, в состав молекул которых входит от пятидесяти до нескольких тысяч остатков аминокислот, называются белками. Молекулы с меньшим количеством мономеров именуются пептидами.

Общие сведения о пептидах и белках

Белок состоит из одной или нескольких длинных неразветвлённых цепей. Каждая цепь называется полипептидом и состоит из аминокислот, скреплённых пептидными связями. Термины «белок» и «полипептид» часто используются свободно, что может вызывать путаницу. Для белка, который включает только одну полипептидную цепь, оба термина являются синонимами.

В природе существуют около 500 аминокислот. В образовании белков обычно (но не всегда) участвуют только 20 из них – их называют белокобразующими. Порядок соединения мономеров в белке определяет его структуру и функции. Многие учёные считают, что аминокислоты были первыми органическими молекулами, появившимися на Земле. Возможно, океаны, которые существовали в начале истории нашей планеты, содержали большое их разнообразие.

Белокобразующие аминокислоты

Автотрофные организмы синтезируют все необходимые им аминокислоты из продуктов фотосинтеза и азотсодержащих неорганических соединений. Для гетеротрофов источником аминокислот являются продукты питания. В организме человека и животных некоторые аминокислоты могут синтезироваться из продуктов обмена веществ (в первую очередь — из других аминокислот). Такие аминокислоты называются заменимыми.

Другие же, так называемые незаменимые аминокислоты, не могут быть собраны в организме и поэтому должны постоянно поступать в него в составе белков пищи. Протеины, содержащие остатки всех незаменимых аминокислот, называются полноценными. Неполноценные белки – это те, в составе которых отсутствуют остатки тех или иных незаменимых аминокислот.

Незаменимыми аминокислотами для человека являются: триптофан, лизин, валин, изолейцин, треонин, фенилаланин, метионин и лейцин. Для детей незаменимыми являются также аргинин и гистидин.

Полипептидные цепи могут быть очень длинными и включать самые разные комбинации аминокислотных остатков. Каждый конкретный белок характеризуется строго постоянным составом и последовательностью аминокислот.

Димер мембранного белка кальсеквестрина.
Deposition authors: Wang, S., Trumble, W.R., Liao, H., Wesson, C.R., Dunker, A.K., Kang, C., CC BY 3.0

Белки, образованные только остатками аминокислот, называются простыми. Сложными являются протеины, имеющие в своём составе компонент неаминокислотной природы. Это могут быть ионы металлов (Fe2+, Zn2+, Mg2+, Mn2+), липиды, нуклеотиды, сахара и др. Простыми белками являются альбумины крови, фибрин, некоторые ферменты (трипсин) и др. Сложные белки – это большинство ферментов, иммуноглобулины (антитела).

Состав аминокислот

Аминокислоты, как следует из их названия, содержат основную аминогруппу (— NH2), а также кислотную карбоксильную группу (—COOH), обе они связаны с центральным атомом углерода. Углерод дополнительно скреплен с водородом и функциональной белковой группой, называемой радикалом (R). Эти компоненты полностью заполняют все связи центрального атома углерода.

Общая структура α-аминокислот, составляющих белки (кроме пролина).
Автор: User:X-romix

Уникальный характер каждой аминокислоты определяется природой группы радикала. Обратите внимание, что если группа радикала не содержит атома водорода (Н), как в глицине, то аминокислота хиральна и может существовать в форме двух энантиомеров: d или L. В белках живых систем содержатся обычно α (L)-аминокислоты, а β (d)-аминокислоты встречаются крайне редко.

Группа радикала определяет химические свойства аминокислот – они могут быть полярными или неполярными, гидрофобными или гидрофильными. Серин с радикалом -CH2OH является полярной молекулой, Аланин, который имеет –CH3 как группу радикала – неполярен.

Существуют также основные аминокислоты (более чем с одной аминогруппой) и кислые аминокислоты (более чем с одной карбоксильной группой). Наличие дополнительной амино- или карбоксильной группы оказывает влияние на свойства аминокислоты, которые играют определяющую роль в формировании пространственной структуры белка.

В состав радикала некоторых аминокислот (например, цистеина) входят атомы серы. Все 20 аминокислот сгруппированы в пять химических классов, основанных на группе их радикала.

  1. Неполярные аминокислоты, такие как лейцин, часто имеют в качестве радикала —CH2 или —CH3.
  2. Полярные незаряженные аминокислоты, такие как треонин, с радикалом, содержащим кислород или гидроксильную группу (-OH).
  3. Заряженные аминокислоты, такие как глутаминовая кислота, с радикалом, имеющим кислоты или основания, способные к ионизации.
  4. Ароматические аминокислоты, такие как фенилаланин, имеющий группу радикала, содержащую органическое (углеродное) кольцо с чередованием одиночных и двойных связей. Они также неполярны.
  5. Аминокислоты, обладающие особыми функциями и свойствами. Например, метионин, который часто является первой аминокислотой в цепи белков, пролин, вызывающий перегибы в цепях, цистин, связывающий цепи вместе.

Каждая аминокислота влияет на форму белка по-разному, в зависимости от химической природы боковых групп. Например, части белковой цепи с многочисленными неполярными аминокислотами сворачиваются внутрь своей цепи путём гидрофобного исключения.

Белки и пептидные связи

В дополнении к группе радикала каждая аминокислота имеет положительно заряженную аминогруппу (NH3 +) на одном конце и отрицательно заряженную гидроксильную группу (COO -) на другом. Амино- и карбоксильные группы у пары аминокислот могут подвергаться реакции дегидрации (выделение молекулы воды) с образованием ковалентной связи. Ковалентная связь, скрепляющая две аминокислоты, называется пептидной. Скреплённые таким способом аминокислоты не могут свободно вращаться вокруг N-C связи. Этот факт является основным фактором образования конструкции белковых молекул.

Пептидная связь

Наличие как основной, так и кислотной групп обусловливает амфотерность (проявление как кислотных, так и основных свойств) и высокую реакционную способность аминокислот.

При соединении двух аминокислот образуется дипептид. На одном конце молекулы дипептида находится свободная аминогруппа, на другом — свободная карбоксильная группа. Благодаря этому дипептид может присоединять к себе другие аминокислоты, образуя олигопептиды. Если таким образом соединяется более 10 остатков аминокислот, то образуется полипептид.

Новаторская работа Фредерика Сангера в начале 1950-х годов доказала, что каждый вид белка имеет определённую аминокислотную последовательность. Для отщепления аминокислот он использовал химические методы, после этого определял их. Сангер преуспел в расшифровке аминокислотной последовательности инсулина. Он продемонстрировал, что все молекулы инсулина имеют одинаковый состав аминокислот.

Уровни структурной организации белков

Форма белка определяет его функцию. Один из способов изучить что-то столь же маленькое как белок – посмотреть на него при помощи коротковолнового излучения, которое представлено рентгеновскими лучами. Рентгеновские лучи пропускают через белок для получения дифракции его узора. Эта картинка кропотливо анализируется и позволяет исследователю построить трёхмерное изображение молекулы с положением каждого её атома. Первым белком, проанализированным таким образом, был миоглобин; вскоре такому же анализу был подвергнут связанный с ним белок гемоглобин.

Когда было изучено достаточное количество протеинов, стал очевиден общий принцип их строения: в каждом исследованном белке все внутренние аминокислоты, такие как лейцин, валин и фенилаланин, неполярны. Тенденция воды к исключению неполярных молекул буквально толкает такие части цепи аминокислот внутрь протеина. Неполярные аминокислоты вынуждены тесно контактировать друг с другом, оставляя мало свободного места внутри молекулы. Полярные и заряженные аминокислоты концентрируются на поверхности белка, за исключением немногих, играющих ключевые функциональные роли.

Структура белков, как правило, описывается как иерархия четырёх уровней: первичного, вторичного, третичного и четвертичного. Мы рассмотрим эту точку зрения, а затем интегрируем её с более современным подходом, вытекающим из расширяющихся знаний о белковой структуре.

Уровни организации молекул белка

Первичная структура белков

Первичная структура белка – это его аминокислотная последовательность, т. е. это цепочка из множества аминокислотных остатков, соединённых пептидными связями. Это наиболее важная структура, так как именно она определяет форму, свойства и функции белка. На основе первичной структуры создаются другие формы молекулы.

Группы радикалов, которыми отличаются аминокислоты, не играют роли в пептидной цепи белков и протеин может включать любую последовательность аминокислот. Так как любая из 20 аминокислот может появиться в любом месте, белок, содержащий 100 мономеров, может образовать любую из 20 100 различных аминокислотных последовательностей. Это важное свойство белков позволяет им быть разнообразными, но каждый из них функционирует только при определённой аминокислотной последовательности.

Вторичная структура белка

Боковые и пептидные группы полипептидных цепей могут образовывать водородные связи. Вторичная структура белка возникает в результате связывания атомов водорода NH-групп и кислорода CO-групп. Полипептидная цепь при этом спирально закручивается. Водородные связи слабые, но благодаря их большому числу они обеспечивают стабильность этой структуры. Спиральную конфигурацию имеют, например, молекулы кератина, миозина и коллагена.

Водородные связи пептидов могут образовываться с водой. Если связей с водой будет слишком много, белки не смогут приобрести глобулярной структуры. Лайнус Полинг предположил, что пептидные группы могут взаимодействовать друг с другом, если пептид свёрнут в спираль, которую он назвал α-спиралью. Этот вид регулярного взаимодействия в пептиде формирует его вторичную структуру.

Вторичная структура инсулина

Другая форма вторичной структуры формируется между зонами пептида, расположенными в один ряд, в результате чего получается плоская молекула, собранная в складки, называемая β-листом. Части белка могут быть либо параллельными, либо антипараллельными – в зависимости от того, являются ли смежные участки пептида ориентированными в одном или в противоположном направлении.

Эти два вида вторичной структуры создают зоны белка – цилиндрические (α-спирали) и плоские (β-листы). Конечная структура белка может включать области каждого типа вторичной структуры. Например ДНК-связывающие белки обычно имеют области α-спирали, которые могут лежать поперёк ДНК и взаимодействовать непосредственно с основаниями ДНК. Белки порины, образующие отверстия в мембранах, состоят из β-листов. В гемоглобине α и β-структуры (глобины) имеют в молекуле свои зоны.

Вторичная структура белков

Третичная структура белков

Окончательная структура химически связанных белков называется третичной. Третичная структура формируется за счет образования водородных, ионных и других связей, возникающих в водной среде между разными группами атомов белковой молекулы вторичной структуры.

У некоторых белков важную роль в образовании третичной структуры играют S – S связи (дисульфидные) между остатками цистеина (аминокислоты, содержащей серу). При этом полипептидная спираль укладывается в своеобразный клубок (глобулу) таким образом, что гидрофобные аминокислотные радикалы погружаются внутрь глобулы, а гидрофильные располагаются на поверхности и взаимодействуют с молекулами воды. Третичной структурой определяются специфичность белковых молекул, их биологическая активность. Её имеют многие белки, например миоглобин (белок, который участвует в создании запаса кислорода в мышцах) и трипсин (фермент, расщепляющий белки пищи в кишечнике).

Третичная структура стабилизируется рядом сил, в том числе:

  • водородными связами между радикалами различных аминокислот;
  • электростатическим притяжением радикалов с противоположными зарядами;
  • гидрофобным исключением неполярных радикалов;
  • ковалентными дисульфидными связами.

На стадии третичной структуры по форме молекул белки можно разделить на две группы:

  • глобулярные – имеют округлую форму. Такую форму имеют глобулины и альбумины крови, фибриноген, гемоглобин;
  • фибриллярные – характеризуются вытянутой, нитевидной формой молекул. Это кератин, коллаген, миозин, эластин и др.

Четвертичная структура белка

Когда два или более полипептида связываются с образованием функционального белка, отдельные его цепи называются субъединицами. Расположение этих субъединиц и есть четвертичная структура. Субъединицы в таких белках чаще всего неполярны, поэтому они не связаны химически и отвечают за отдельные виды деятельности. Прочность четвертичной структуры обеспечивается взаимодействием слабых межмолекулярных сил.

Четвертичная структура характерна для белка гемоглобина. Вспомните, что гемоглобин состоит из двух α-цепей и двух β-цепей, а ещё в его состав входит небелковый компонент – гем.

Субъединицы располагаются в их окончательной четвертичной структуре. Это конечная структура некоторых, но не всех белков. У протеинов, которые состоят только из одной полипептидной цепи, например у фермента лизоцима, конечной структурой является третичная.

Мотивы и домены – структурные элементы белков

Ручное определение последовательности аминокислот в белке – трудоёмкая работа. Эту ситуацию изменило открытие способности хранения информации о белке молекулой ДНК. Первоначально геном человека был расшифрован вручную. Появление технологий следующего поколения привело к заметному ускорению секвенирования.

Сегодня расшифрованы более 40 000 бактериальных геномов и почти 8 000 геномов эукариот, в том числе 80 последовательностей генов млекопитающих. Так как состав ДНК имеет непосредственное отношение к последовательности аминокислот в белках, у биологов теперь есть огромная база данных строения протеинов.

Новая информация заставила задуматься о логике генетического кода и основных закономерностях структуры белка. Исследователи до сих пор рассматривают иерархическую систему из четырёх уровней как важную, но в лексикон биологов вошли и новые термины: мотив укладки и белковый домен.

Мотив укладки белковых молекул

Когда биологи обнаружили третичную структуру белка (ещё более трудоёмкая работа, чем определение последовательности аминокислот в цепи), они заметили сходные элементы, расположенные в непохожих белках. Подобные структуры называются мотивами, а иногда «сверхсекундными структурами». Термин «мотив» заимствован из искусства и относится к тематическому повторяющемуся элементу в музыке или дизайне.

Один общий мотив β-α-β образует так называемую «складку Россмана» у большого количества протеинов. Вторым часто встречающимся мотивом является β-баррель, который представляет собой β-лист, сложенный по кругу, чтобы сформировать трубку. Третий тип мотива – спираль-поворот-спираль, состоит из двух α-спиралей, разделённых изгибом. Его используют белки для связывания с молекулой ДНК.

Логику структуры мотивов укладки исследователи до сих пор не могут понять. Вероятно, если аминокислоты являются буквами в языке белков, то мотивы представляют собой повторяющиеся слова или фразы. Мотивы укладки помогли определить неизвестные функции белков, а база данных белковых мотивов используется для поиска новых неизвестных протеинов.

Мотивы укладки являются довольно консервативными и встречаются в белках, которые не имеют ни функциональных, ни эволюционных связей. Определение мотивов укладки лежит в основе физической, или рациональной классификации белков.

Белковые домены

Домены – это функциональные единицы в виде глобулы внутри более крупной структуры белков. Их можно рассматривать как субструктуры внутри третичной структуры белка. В языке белков это «абзацы». Большинство белков состоит из нескольких доменов, которые выполняют различные части функций протеинов.

Во многих структурах эти домены могут быть физически разделены. Например, так устроены факторы транскрипции – белки, которые связываются с ДНК и инициируют построение РНК по комплементарной ей ДНК. Было выяснено, что если ДНК-связывающие области поменять местами с факторами транскрипции, специфичность фактора может быть изменена без изменения его способности стимулировать транскрипцию. Эксперименты по замене доменов были проведены со многими факторами транскрипции, и они указывают, что активационные и ДНК-связывающие домены действуют отдельно.

Эти образования также могут помогать протеинам складываться. По мере того, как полипептидная цепь приобретает свою структуру, домены принимают правильную форму. Это действие может быть продемонстрировано экспериментально. Искусственное продуцирование фрагмента полипептида, который образует домен в интактном белке, показывает, что фрагмент складывается, чтобы сформировать такую же структуру, как у прототипа.

Процесс складывания, белки-шапероны

Первоначально биохимики думали, что новоиспечённые белки сворачиваются спонтанно, пробуя различные конфигурации, как гидрофобные взаимодействия с водой толкают неполярные аминокислоты внутрь белков до тех пор, пока не будет достигнута их окончательная структура. Оказалось, что эта точка зрения слишком проста. Цепи протеинов могут быть сложены многими способами, поэтому пробы и ошибки заняли бы слишком много времени. По мере того как первичная цепь складывается, приобретая финальную структуру, неполярные «липкие» внутренние участки во время промежуточных стадий обнажаются. Если эти промежуточные формы поместить в пробирку со средой, идентичной той, что внутри клетки, они прилипают к другим, и нежелательные белки-партнёры образуют клейкую массу.

Как клетки избегают того, чтобы их белки слипались в массу? Ответ на вопрос появился во время изучения необычных мутаций, которые спасают бактериальные клетки от размножения внутри них вирусов. При этом белки вирусов, произведённые внутри клетки, не могут сложиться как следует. Дальнейшее исследование помогло выяснить, что клетки содержат белки-шапероны, помогающие другим белкам складываться правильно.

Свёртывание белков

В настоящее время молекулярные биологи выявили массу белков, действующих как шапероны. Это большой класс полимеров, который можно разделить на подклассы. Представители шаперонов были найдены в каждом исследуемом организме. Некоторые из них, называемые тепловыми шоковыми белками, вырабатывается в ответ на повышение температуры тела. Высокие температуры служат фактором денатурации белков, шоковые белки-шопероны помогают белкам правильно сворачиваться и в такой ситуации.

Один из хорошо изученных классов этих белков, названных шаперонинами, был изучен у кишечной палочки (Escherichia coli). У мутантов при инактивации шаперонинов 30% бактериального белка не складывались должным образом. Шаперонины собираются в комплекс, напоминающий цилиндрический контейнер. Белки могут заходить в этот контейнер, и даже неправильно сложенные молекулы складываются там заново.

Исследователи склонны думать о белках как о фиксированных структурах, но это не относится к шаперонинам. Их гибкость поразительна. Видимо, это нужно им для выполнения своих функций. Клетки используют эти белки для складывания некоторых молекул протеинов и восстановления их неправильной структуры.

Денатурация инактивирует белки

Еще одной важной особенностью белков является то, что они проявляют свою активность лишь в узких температурных рамках и в определённом диапазоне кислотности среды.

Если условия, окружающие белок, изменяются, то он может частично потерять свою структуру или полностью развернуться. Этот процесс называется денатурацией. Белки могут быть денатурированы, когда рН, температура или ионная концентрация окружающего раствора изменена. Денатурация происходит вследствие разрыва водородных, ионных, дисульфидных и других связей, стабилизирующих пространственную структуру белковых молекул. При этом может утрачиваться их четвертичная, третичная и даже вторичная структуры.

Денатурированные белки как правило биологически неактивны. Это особенно значимо в отношении ферментов: так как почти каждая химическая реакция происходит при их помощи, жизненно важно, чтобы они функционировали нормально.

До появления морозильников и холодильников единственным способом предохранения продуктов от размножения в них микроорганизмов было хранение их внутри раствора, содержащего высокую концентрацию соли или уксуса, которые денатурировали ферменты микроорганизмов и предотвращали их рост.

Большинство ферментов функционирует в очень узком диапазоне условий окружающей среды. У каждого энзима этот диапазон специфичен. Ферменты крови, которые работают при рН около 7,4, быстро денатурируют в кислой среде желудка. И наоборот, протеолитические ферменты желудка, работающие при рН=2 или менее, разбираются в основной среде крови. Аналогично у организмов, живущих вблизи океанических гидротермальных источников, есть ферменты, которые хорошо работают только в экстремальных температурах (до 100°С). Эти организмы не могут выжить в более прохладных водах, потому что их энзимы не функционируют должным образом при относительно низких температурах.

Если нормальные показатели окружающего раствора восстанавливаются, небольшой белок, не потерявший первичной структуры, может восстановиться. Этот процесс называется ренатурацией, он происходит благодаря взаимодействию неполярных аминокислот и воды. Первоначально этот процесс был установлен для энзима рибонуклеазы, его ренатурация привела к выводу, что первичная структура определяет третичную структуру белка. Более сложные белки редко складываются вновь из-за их сложной окончательной структуры. Их денатурация носит необратимый характер.

Важно отличать денатурацию от диссоциации. Субъединицы белков с четвертичной структурой могут быть диссоциированы (разделены) без потери своей индивидуальной третичной структуры. Например, молекула гемоглобина может диссоциировать на 4 молекулы (2 α-глобина и 2 β-глобина) без денатурации свёрнутых глобиновых белков. Они легко восстанавливают свою четвертичную структуру из четырёх субъединиц.

 

 

Вам будет интересно

Белки. Химические и физические свойства. Биологические функции.

Белки — высокомолекулярные органические соединения, состоящие из остатков аминокислот, соединённых в длинную цепочку пептидной связью.

В состав белков живых организмов входит всего 20 типов аминокислот, все из которых относятся к альфа-аминокислотами, а аминокислотный состав белков и их порядок соединения друг с другом определяются индивидуальным генетическим кодом живого организма.

Одной из особенностей белков является их способность самопроизвольно формировать пространственные структуры характерные только для данного конкретного белка.

первичная последовательность соединения остатков аминокислот
вторичная

локальное упорядочивание фрагмента полипептидной цепи в спирали

третичная

пространственная ориентация полипептидной спирали или способ ее укладки определенном объеме в глобулы (клубки) или фибриллы (нити)

Из-за специфики своего строения белки могут обладать разнообразными свойствами. Например, белки, имеющие глобулярную четвертичную структуру, в частности белок куриного яйца, растворяются в воде с образованием коллоидных растворов. Белки, обладающие фибриллярной четвертичной структурой в воде не растворяются. Фибриллярными белками, в частности, образованы ногти, волосы, хрящи.

Химические свойства белков

Гидролиз

Все белки способны вступать в реакцию гидролиза. В случае полного гидролиза белков образуется смесь из α-аминокислот:

Белок + nH2O => смесь из α-аминокислот

Денатурация

Разрушение вторичной, третичной и четвертичной структур белка без разрушения его первичной структуры называют денатурацией. Денатурация белка может протекать под действием растворов солей натрия, калия или аммония – такая денатурация является обратимой:

Денатурация же протекающая под действием излучения (например, нагрева) или обработке белка солями тяжелых металлов является необратимой:

Так, например, необратимая денатурация белка наблюдается при термической обработке яиц в процессе их приготовления. В результате денатурации яичного белка его способность растворяться в воде с образованием коллоидного раствора исчезает.

Качественные реакции на белки

Биуретовая реакция

Если к раствору, содержащему белок добавить 10%-й раствор гидроксида натрия, а затем небольшое количество 1 %-го раствора сульфата меди, то появится фиолетовое окрашивание.

раствор белка + NаОН(10%-ный р-р) + СuSO4   =   фиолетовое окрашивание

Ксантопротеиновая реакция

растворы белка при кипячении с концентрированной азотной кислотой окрашиваются в желтый цвет:

раствор белка + HNO3(конц.) => желтое окрашивание

Биологические функции белков

каталитическая ускоряют различные химические реакции в живых организмах ферменты
структурная строительный материал клеток коллаген, белки клеточных мембран
защитная защищают организм от инфекций иммуноглобулины, интерферон
регуляторная регулируют обменные процессы гормоны
транспортная перенос жизненно-необходимых веществ от одних частей организма к другим гемоглобин переносит кислород
энергетическая снабжают организм энергией 1 грамм белка может обеспечить организм энергией в количестве 17,6 Дж
моторная (двигательная) любые двигательные функции организма миозин (мышечный белок)

Что такое белки — строение и функции

Белки играют центральную роль в организме человека, выполняя одни из самых важных функций: двигательную, защитную, биологическую, регуляторную и другие.

Без этих универсальных молекулярных машин жизнь на нашей планете и вовсе не могла бы появиться.

В данной статье мы подробно рассмотрим что такое белки, какие существуют виды, где содержатся и многое другое.

Что такое белок и каковы его функции

На уроках биологии и химии довольно много времени уделяется этой важной теме. Белки (protein) являются природными гетерополимерами, состоящие из α-аминокислот. Соединяет их вместе пептидная связь. Для синтеза огромного множества белков в человеческом организме используется 20.

Состав каждого белка, синтезированного в организме, определяется геномом. Различные комбинации генетического кода позволяют создавать из стандартных аминокислот огромное множество белков, отвечающих за разнообразные функции в нашем теле.

Некоторые белки довольно сложно классифицировать исключительно по их функциям. Так как один белок часто может отвечать за выполнение нескольких задач.

Список функций белков выглядит следующим образом:

  1. Структурная – отвечает за образование цитоскелета клеток, придает форму разным тканям. Наиболее известные — это коллагены и эластин, входящие в состав межклеточного вещества. А также кератин – основной белок, формирующий ногти и волосы.
  2. Защитная функция разделяется на физическую, иммунную и химическую. За физическую защиту в основном отвечают тромбины, свертывающие кровь, и коллагены и кератин, формирующие роговые щитки, волосы, кожу. Химическую защиту от различных токсинов в организме выполняют в основном ферменты печени. Они растворяют токсины, позволяя быстрее вывести их. За иммунную защиту отвечают различные иммуноглобулины.
  3. Каталитическая функция использует ферменты. Это особые белки, позволяющие катализировать реакции, расщепляющие большие молекулы, или же наоборот их синтезировать. Ферменты позволяют ускорять все химические реакции в сотни и тысячи раз. За последнее время науке стало известно свыше 5000 различных ферментов.
  4. Регуляторная функция отвечает за управление всей жизнедеятельностью клетки. Белки из данной группы регулируют количество и активность остальных белков, а также множество процессов внутри самой клетки.
  5. Сигнальная функция выполняется гормонами и цитокинами. Эти белки являются сигнальным веществом, позволяя передавать информацию или сигналы частями организма.
  6. Транспортная – позволяет переносить различные вещества от одних органов и клеток к другим. Наиболее известный пример – это гемоглобин, транспортирующий кислород и углекислый газ.
  7. Запасная функция. Ее выполняют белки, запасающиеся в организме для экстренных случаев в качестве энергии или источника аминокислот.
  8. Рецепторная. Ее выполняют белки, реагирующие свет, физическое воздействие или химическое вещество.
  9. Моторная функция выполняется целыми группами белков. Среди них, например, актин и миозин. Они являются основными компонентами мышц и позволяют им сокращаться. Другие белки позволяют клеткам лейкоцитов передвигаться внутри организма.

Строение белков

Беки относятся к линейным полимерам. В их составе могут присутствовать несколько α-амиокислот и неаминокислотные компоненты. На первый взгляд всего 20 аминокислот – это небольшой выбор.

Но на самом деле молекула белка, состоящая всего из 5 компонентов аминокислот, может иметь свыше миллиона вариантов построения. Небольшой белок может иметь в своей цепочке сотню аминокислотных остатков.

При синтезе белка аминокислоты соединяются благодаря пептидной связи. Они соединяются разными концами, одна с помощью карбоксильной группы (-COOH), а другая аминогруппой (-NH2). При таком соединении у белка появляются два соответственных конца С и N.

Структуры белков

Структурные организации белков классифицируют на 4 уровня. Это первичная, вторичная, третичная и четвертичная структуры.

Первичная представляет собой стандартную цепочку аминокислот. Их последовательность закодирована генетически. Она обычно описывается трехбуквенными обозначениями аминокислотных остатков в цепочке.

Вторичная представляет собой упорядоченно свернутую спиралеобразно цепочку аминокислот. Она напоминает пружинку. У спирали стабильная структура, так как ее витки крепятся между собой водородными связями. Почти все СО- и NН- группы устанавливают друг с другом такие связи. Среди белков данной структуры особенно выделяются коллагены и кератин.

Третичная – в основном формируется благодаря гидрофильно-гидрофобным взаимодействиям. Возникающие водородные ионные и дисульфидные связи способствуют взаимодействию между радикалами аминокислот. Благодаря этому полипептидная связь укладывается в специальные глобулы. К белкам третичной структуры уже относятся множество ферментов, антител и гормонов.

Четвертичная – присуща сложным формам ферментов или белков, которые состоят из 2 или 3 глобул. Они связываются в молекуле как ионными, так и гидрофобными взаимодействиями. А иногда возникают электростатические взаимодействия или дисульфидные связи. Наиболее известный и изученный белок данной классификации – гемоглобин.

Протеины и протеиды — простые и сложные белки

Еще одна классификация белков это – протеины и протеиды. Первые — это простые белки, в состав которых входят исключительно остатки аминокислот. А вот в протеидах, помимо основного скелета из аминокислот, присутствуют еще не белковые группы (простетические).

В зависимости от дополнительной небелковой составляющей протеиды делят на другие группы:

  1. Липопротеины – включают в себя различные липиды. В основном данные белки выполняют транспортировку липидов.
  2. Фосфопротеины – имеют фосфорную кислоту. К таким белкам относятся вителлин и казеноген.
  3. Металлопротеины – могут иметь катионы одного и более металлов в своей структуре. Наиболее известен гемоглобин с молекулами железа.
  4. Гликопротеины – имеют в своем составе различные углеводы.
  5. Нуклеопротеины – являются главными белками, отвечающими за передачу наследственной информации.

Физико-химические свойства белков

Белки проявляют свойства амфотерности (от греч. «двойственность). Они могут в зависимости от различных факторов проявлять как кислотные, так и основные свойства.

Также белки могут быть растворимыми или не растворимыми в воде. На растворимость могут влиять как сама структура белка, так и характер растворителя, pH самого раствора или ионная сила.

Белки могут быть гидрофобными или гидрофильными. Последние в основном располагаются в ядре, цитоплазме или межклеточном веществе.

Еще одно свойство белков это денатурация. Это так называемая потеря четвертичной, третичной структур. Белки отлично приспособлены для жизни и функционирования в условиях организма, но при резком изменении внешних условий структура белка может разрушиться.

Среди таких воздействий выделяют ультразвук, высокие и низкие температуры, облучения, встряхивания, вибрации, а также действие кислот или щелочей. Денатурация может быть как частичной, так и полной, или же обратимой и необратимой.

Значение белков для организма

Как мы увидели из вышеприведенных функций и особенностей, белки имеют огромное значение для организма человека. Они придают форму клеткам и тканям организма, переносят различные элементы между органами и клетками, отвечают за восприятие окружающего мира.

Белки защищают нас от природных факторов и от воздействий вредоносных микроорганизмов. Без них в принципе невозможно как минимум прохождение химических реакций в организме и обмен веществ, так и наличие жизни как самовоспроизводящейся структуры. По истине, роль белков сложно переоценить.

Что относится к белковой пище

Белки являются одним из самых основных строительных материалов для нашего организма. Поэтому, чтобы питание снабжало организм человека нужными веществами, следует всегда иметь в рационе белковые продукты.

Богаты по содержанию белка следующие:

  • мясо;
  • рыба;
  • различные морепродукты;
  • яйца;
  • бобовые;
  • молочные продукты.

Заключение

Белок является одним из ключевых элементов жизни на нашей планете. Он отвечает за множество процессов и функций в живом организме, а недостаток белков может вызвать серьезные заболевания.

Большое разнообразие источников белка убережет ваш организм от недостатка незаменимых аминокислот и множества других ценных элементов питания. Старайтесь не исключать белковые продукты из рациона и будьте здоровы.

Белки 🐲 СПАДИЛО.РУ

Теория для подготовки к блоку «Цитология»

Белки – наиболее важные органические соединения клетки. Их содержание колеблется от 50% до 80% в разных клетках организма.

Строение белков

В состав белков, кроме 4 основных химических элементов (углерод, кислорода, водород, азот), могут входит фосфор, сера, железо. Белки – сложные высокомолекулярные соединения, которые составлены из аминокислотных последовательностей. Аминокислоты состоят из двух частей: аминогруппы -NH2 и карбоксильной группы -COOH. Первая несет в себе основные свойства, а вторая – кислотные, что обуславливает активности и амфотерность этих соединений (Амфотерность – проявление кислотных или основных свойств в зависимости от реакции). Аминокислоты отличаются радикалами.

Строение аминокислоты

Аминокислоты ассоциируются с генетическим кодом, так как последовательности нуклеотидов кодируют триплеты нуклеотидов. Такие задачи изучаются в школе и встречаются в ЕГЭ. Всем, кто сталкивался с генетикой, хорошо знакома таблица аминокислот:

Таблица аминокислот

В один белок может входить много аминокислот. Они соединяются в цепь посредством образования пептидных связей: азот одной аминокислоты связывается с углеродом другой аминокислоты:

Строение белка. Зеленым цветом обозначена карбоксильная группа аминокислоты, голубым цветом — аминогруппа аминокислоты

В состав белка может входить даже несколько аминокислотных цепей. Всего аминокислот насчитывается около 170, однако основное разнообразие задают 20 аминокислот, что связано с тем, что одна аминокислота может кодироваться различными последовательностями кодонов, или другими словами, аминокислота может кодироваться разными триплетами нуклеотидов. Это одно из свойств генетического кода (свойство избыточности).

Некоторые аминокислоты животный организм синтезирует самостоятельно, но, как можно догадаться, не все. Такие аминокислоты называются незаменимыми аминокислотами, их следует употреблять с пищей. Например, лейцин используется не просто как биологическая добавка, что достаточно распространено среди фармакологических компаний, но и применяется при лечении заболеваний печени, а также анемии, она же малокровие.

Классификация белков

Протеины – белки, в состав которых входят только белковые молекулы.

Протеиды – белки, в состав которых, кроме белковых молекул, входят небелковые молекулы.

  • Гликопротеиды (белок + углевод)
  • Липопротеиды (белок + липид)
  • Нуклеопротеиды (белок + нуклеиновые кислоты)

Для того чтобы не путаться в понятиях, нужно вспомнить, что принимают спортсмены для того, чтобы скорее нарастить мышечную массу, то есть протеиновые коктейли, батончики и т.д. Именно протеиновые, это слово на слуху, пусть теперь оно ассоциируется с этой классификацией.

Уровни организации белковой молекулы

Структура белка именуется просто по счету, в зависимости от сложности укладки.

Первичная структура белка представляет собой прямую цепь из аминокислот. Она является главной и определяющей свойства, форму и функции белка.

Вторичная структура белка – уже две цепи. Однако эти цепи не идут параллельно друг другу. Они скручены в спираль и связаны водородными связями, которые их удерживают за счет того, что их много. ДНК была обнаружена именно в форме двойной спирали. В этом виде она наиболее известна.

Третичная структура белка – глобула. Глобула означает шар, что и является описанием структуры белка. В этом случае прочность обусловлена тремя видами связей: водородными, ионными и дисульфидными.

Четвертичная структура белка – это как бы глобула из глобул. Она встречается не у всех белков. Белок крови гемоглобин состоит из 4х субъединиц четвертичной структуры.

Денатурация – утрата белковой молекулой своей природной структуры. Это обратимый процесс, похожий на сохранение в игре. Если белок денатурировал, но его природная структура не нарушена, то он восстановится. Причин разрушения белка может быть много: высокая температура, химические повреждения, радиация, обезвоживание и т.д. Так что когда мы варим яйца или мясо, то происходит денатурация белка. Как мы видим, к исходному состояния он уже не возвращается (не ренатурирует). Денатурацию и ренатурацию просто запомнить по похожим словам: денатурация – деградация – разрушение; ренатурация – регенерация – восстановление.

Денатурация и ренатурация

Функции белков
1.Структурная функция

Белки входят в состав всего в клетке: мембраны и органоиды. Кроме того, есть белки, которые очень важно знать:

  • Коллаген – входит в состав соединительной ткани. Коллаген можно запомнить по кремам, которые обещают продлить молодость и расправить морщины.
  • Кератин – известен всем, кто когда-либо смотрел рекламу шампуня для волос. Кератин входит в структуру волос и прочих производных нашего и животного тела: шерсть, перья, ногти, когти, копыта, рога.
  • Эластин – как понятно из названия, отвечает за эластичность. Она важна а) в связках, так как они должны растягиваться для совершения движений и возвращаться в исходное состояние. Кстати, в том числе и голосовые связки; б) в сосудах, по которым течет кровь порой под большим давлением, с высоким давлением и скоростью.
2.Ферментативная функция

Ферменты – катализаторы (= ускорители химических реакций) белковой природы. С ферментами происходит тесное знакомство в разделе «пищеварение». Есть одно важное правило, которое нужно обязательно запомнить: все ферменты – белки, но не все белки – ферменты.

3.Транспортная функция

Белки-транспортеры осуществляют перенос веществ через мембрану клетки. Очень наглядным примером транспорта белками является белок-переносчик гемоглобин, благодаря которому мы дышим. В мышцах существует аналог этого белка – миоглобин (приставка мио- означает «сокращение», тем самым называя месторасположение белка).

4.Защитная функция

Изучая иммунитет, ученики и студенты знакомятся с антителами – специфическими белками крови, которые вырабатываются иммунными клетками лимфоцитами для борьбы с чужеродными организмами или вредными соединениями. Так антитела сражаются за нас, когда мы хватаем где-то микробов, так же эти белки воюют, когда человеку переливают кровь неподходящей группы или пересаживают орган, который его организм отторгает. Переливание крови неподходящей группы может привести к летальному исходу, так как произойдет агглютинация – склеивание эритроцитов.

Некоторые растения и животные вырабатывают яды или токсины для того, чтобы защитить себя от нападения и поедания. Поэтому не следует есть незнакомые ягоды, грибы и ловить где-нибудь в тропиках лягушек. Это может закончиться плачевно.

Кроме оборонительной и атакующей функции во благо защиты организма, есть и латающая. При порезе и кровопотере молекулы белка тромбина объединяются для того, чтобы закрыть поврежденный сосуд, а тем временем, тонкие нити белка фибрина переплетаются на поверхности раны, образуя тоненькую пленочку. Если порез был несерьезным, то кровотечение успешно остановлено.

5.Регуляторная функция

Некоторые белки являются гормонами. Они отвечают за регуляцию физиологических процессов организма. Наиболее известным примером белкового гормона является инсулин.

6.Энергетическая функция

Как и углеводы с жирами, белки тоже могут быть расщеплены для получения энергии. Однако, чаще всего, аминокислоты, полученные в результате распада белка, снова используются организмом для построения других белков. Это делает для экономии энергии и биологического материала, ведь в случае повторного использования, не нужно тратиться на синтез новых соединений. При расщеплении 1 г белка высвобождается 17,6 кДж энергии.

 

Какова химическая формула белков? + Пример

Биология
Наука
  • Анатомия и физиология
  • Астрономия
  • Астрофизика
  • Биология
  • Химия
  • науки о Земле
  • Наука об окружающей среде
  • Органическая химия
.

Какова химическая формула белка?

вносят свой вклад в механическую структуру животных, включая людей, например кератин в волосах и ногтях и волокнистые белки, такие как коллаген, в сухожилиях; enable ... Каждый белок выполняет свою точную функцию под управлением своего собственного гена. ... Аминокислоты имеют общую структурную молекулярную формулу -Nh3CHRCOOH. узнать больше

По оценкам, существует около 20 000 различных белков и пептидов до триллиона или около того.Не один. узнать больше

Химическая формула протеина C44189H71252N12428O14007S321. имя: SYNE1_HUMAN; номер доступа: Q8NF91) представляет собой белок ядерной оболочки, обнаруженный в человеческих миоцитах и ​​синапсах, который состоит из 8 797 аминокислот. узнать больше

Структура, в которой белковые цепи удерживаются на месте, называется вторичной структурой.Это может быть: спиральное, например кератин (белок, содержащийся в волосах) или; гофрированный лист, например фиброин (белок, содержащийся в шелке). Эти структуры удерживаются на месте водородными связями. Белковые цепи могут складываться в глобулярную форму. узнать больше

.

химическая формула желатина дополняет гидролизат

бычьего коллагена протеина

Химическая формула желатина дополняет протеин гидролизат бычьего коллагена

Основное приложение

Больше ключей

Наше преимущество

Упаковка и доставка

9000 упаковка?

Обычно мы поставляем упаковку по 25 кг / мешок или картон.

2. Прослеживаемость продукции так хороша, хорошо?

Наши продукты зарегистрированы в каждой записи процесса, очень сильная ретроспектива.

3. Когда я могу получить коммерческое предложение по моему запросу?

Обычно в течении суток!

4. В чем преимущество вашей компании?

Мы являемся первым в Китае производителем рецептов листового желатина, и у нас есть собственные исследования и разработки по запатентованным рецептам листового желатина, а во-вторых, у нас есть профессиональная команда для достижения GMP работающего завода и так далее.

5.Как с нами связаться?

Вы можете выбрать интересующую Вас продукцию и отправить нам запрос.

Свяжитесь с нами

.

Поиск молекулярной массы

Примечание: Этот поиск ведется по молекулярной массе на основе атомных масс одного (наиболее распространенного) изотопа. Эти веса могут значительно отличаться от молекулярных. веса основаны на средних атомных массах. Молекулярный веса, указанные в других местах на этом сайте, основаны на средние атомные массы.

Пожалуйста, следуйте инструкциям ниже, чтобы проведите поиск (Помощь):


Справка по поиску молекулярной массы

Параметры поиска (шаг 1) (Вернуться к поиску)

Вы можете искать виды на основе молекулярной массы значения двумя способами:

  • Задайте одно значение; система будет искать значения в пределах 0.5 единиц этой стоимости.
  • Укажите диапазон. Пределы диапазона должны быть разделенными запятой.

Правила ограничения формулы (шаг 2) (Вернуться к поиску)

Можно ввести химическую формулу, чтобы ограничить поиск виды, соответствующие формуле. Способ, которым формула интерпретируется контролируется двумя флажками ниже поле ввода формулы:

Разрешить элементы, не указанные в формуле
Если отмечено, эта опция указывает, что вид содержащие элементы, не указанные в формуле также будут сопоставлены.Например, поиск C2 будет соответствовать всем видам, которые содержат ровно два атома углерода и любое количество другие атомы.
Этот параметр указывает на то, что виды, содержащие больше атомов, чем указано для данного элемента, будут сопоставлены. Например, поиск HC только с эта опция будет соответствовать только углеводородам.

Правила для типов данных (шаг 4) (Вернуться к поиску)

  • Если один или несколько типов данных проверены, поиск будет ограничен видами, которые содержат хотя бы один из указанных типов данных.
  • Если ни один из типов данных не проверен, там не будет ограничений на поиск.
.

Ведолизумаб Химическая формула белка: C6528h20072N1732O2042S42

Презентация на тему: «Химическая формула белка ведолизумаба: C6528h20072N1732O2042S42» - стенограмма презентации:

1 Ведолизумаб Химическая формула белка: C6528h20072N1732O2042S42
Средний вес белка:

2 Описание: Показания: Фармакодинамика:
Ведолизумаб представляет собой рекомбинантное гуманизированное моноклональное антитело IgG1, направленное против интегрина человеческих лимфоцитов α4β7, ключевого медиатора желудочно-кишечного воспаления.Он используется при лечении активного язвенного колита от умеренного до тяжелого и болезни Крона у пациентов, у которых был неадекватный ответ, потеря ответа или непереносимость ингибиторов фактора некроза опухоли альфа (TNF-альфа) или других традиционных методов лечения. . Блокируя свою основную мишень, интегрин α4β7, ведолизумаб уменьшает воспаление в кишечнике. Показания: Он показан взрослым пациентам с умеренно или сильно активным ЯК или БК, у которых был неадекватный ответ, потеря ответа на блокатор или иммуномодулятор фактора некроза опухоли (TNF) или непереносимость; или имели неадекватный ответ, были непереносимы или продемонстрировали зависимость от кортикостероидов.Фармакодинамика. Доклинические исследования показали, что фармакодинамические эффекты ведолизумаба обратимы после удаления антитела: фармакологическая активность клеток, ингибируемых ведолизумабом, может частично восстанавливаться в течение 24 часов после удаления, с почти полным восстановлением в течение 4 дней. Нет известных лекарственных взаимодействий, поскольку ведолизумаб является гуманизированным антителом и не модулирует выработку цитокинов, которые, как известно, влияют на метаболизм лекарств.

3 Токсичность: Механизм действия:
Ведолизумаб связывается с интегрином α4β7, ключевым медиатором желудочно-кишечного воспаления, экспрессирующимся на поверхности T- и B-лимфоцитов.Селективно ингибируя интегрин α4β7, ведолизумаб подавляет адгезию лимфоцитов к своему естественному лиганду, молекуле-1 адгезии клеток адгезии слизистых оболочек (MAdCAM-1), тем самым предотвращая попадание лимфоцитарных клеток в собственную пластинку кишечника и кишечную лимфоидную ткань (GALT). В частности, ингибирование этого пути облегчает воспаление желудочно-кишечного тракта без нарушения системных иммунных ответов. Токсичность: Долгосрочные исследования на животных не проводились для оценки канцерогенного потенциала, мутагенности или возможных нарушений фертильности.Повышенные уровни трансаминаз с повышенным билирубином или без него наблюдались у пациентов, получавших этот препарат. О прогрессирующей мультифокальной лейкоэнцефалопатии (ПМЛ) при использовании этого препарата не сообщалось, однако она наблюдалась у пациентов, получавших различные антагонисты рецепторов интегрина, и поэтому считается риском для этого продукта. Использование ведолизумаба может увеличить риск развития инфекций, и одно исследование показало, что назофарингит чаще возникает при приеме ведолизумаба, чем при приеме плацебо у пациентов с БК.

4 Объем распределения
Метаболизм Ожидаемым следствием метаболизма является протеолитическая деградация до небольших пептидов и отдельных аминокислот, а также опосредованный рецептором клиренс.Абсорбция. Предполагаемый путь введения - внутривенный, поэтому данных по абсорбции нет, а биодоступность ожидается на уровне 100%. Объем распределения Было обнаружено, что кажущийся объем распределения в сыворотке в стабильном состоянии умеренно превышает объем сыворотки. Следовательно, ожидается, что он будет ограничиваться системным кровотоком, как и ожидалось для высокомолекулярного белка. Клиренс низкий до мл / час / кг. Категория Иммунодепрессивное средство, Противоопухолевое средство Взаимодействие с другими лекарственными средствами Адалимумаб, Белимумаб, Цертолизумаб пегол, Деносумаб, Этанерцепт, Голимумаб, Инфликсимаб, Лефлуномид, Леналидомид, Натализумаб, Такролимус, Талидомид-Талидумизумаб, Талидомал-Савлизумаб, Белимумаб, Талидомид и Натализумаб, Белимумабин 4, Интегрин бета-7

5 Последовательность: последовательность тяжелой цепи QVQLVQSGAEVKKPGASVKVSCKGSGYTFTSYWMHWVRQAPGQRLEWIGEIDPSESNTNY


6 Бренды: Entyvio Компания: Takeda Pharmaceuticals America, Inc.Описание: Это антагонист рецептора интегрина, гуманизированное моноклональное антитело IgG1, продуцируемое в клетках яичника китайского хомячка, которое связывается с интегрином α4β7 человека. ENTYVIO имеет приблизительный молекулярный вес 147 килодальтон. Используется / Назначено для: Показан при язвенном колите у взрослых и болезни Крона у взрослых. Форма: раствор для инъекций, порошок, лиофилизированный. Способ введения: внутривенно.

7 Дозировка: Рекомендуемая доза ENTYVIO для взрослых с язвенным колитом или болезнью Крона составляет 300 мг внутривенно через нулевую, две и шесть недель, а затем каждые восемь недель. ENTYVIO или любое из его вспомогательных веществ (например, одышка, бронхоспазм, крапивница, приливы, сыпь и учащенное сердцебиение).Побочные эффекты: наиболее частыми побочными реакциями были назофарингит, головная боль, артралгия, тошнота, гипертермия, инфекции верхних дыхательных путей, усталость, кашель, бронхит, грипп, боли в спине, сыпь, зуд, синусит, боль в ротоглотке и боль в конечностях.

.

Формула этанола, кипение, точка плавления, pH, плотность, растворимость

Химические свойства этанола

Химическая формула

Химическая формула этанола: C 2 H 5 OH.

Рисунок 1. Структурная и молекулярная формула этанола.
Этанол, как и все спирты, имеет гидроксильную группу
, присоединенную к насыщенному атому углерода.

калорий

1 грамм этанола обеспечивает 7 калорий (килокалорий) «метаболизируемой энергии» или 6.1 Калории из «чистой метаболической энергии [7] ».

Физические свойства этанола

Внешний вид, запах и вкус

При комнатной температуре этанол представляет собой прозрачную бесцветную летучую жидкость с характерным запахом. В разбавленном виде он несколько сладкий, но концентрированный спирт имеет сильный жгучий вкус [1] .

Растворимость

Этанол хорошо растворим в воде и органических растворителях, но плохо растворим в жирах и маслах [1] .

Плотность

Плотность этанола при 68 ° F (20 ° C) составляет 0,789 г / мл [1] .

pH

Чистый этанол нейтрален (pH ~ 7) [2] . Большинство алкогольных напитков более или менее кислые: столовое вино pH = 3,3–3,7 [3] , pH пива ~ 4 [4] .

Температура кипения

Точка кипения этанола составляет 173,3 ° F (78,5 ° C) [1]

Точка плавления

Точка плавления этанола составляет -173,4 ° F (-114.1 ° С) [1] .

Точка замерзания

  • Вино (10% алкоголя по объему): -4 ° C (25 ° F)
  • Водка (40% спирта по объему): -10 ° F (-23 ° C)
  • Чистый спирт (100% спирта по объему): -175 ° F (-115 ° C) [5]

Температура воспламенения

Температура вспышки - это температура, при которой этанол воспламеняется и может загореться:

  • Пиво (5% спирта по весу) может загореться в случае воспламенения при 144 ° F (62 ° C),
  • Вино (10% алкоголя по весу) при температуре 120 ° F (49 ° C),
  • Водка (40% спирта по весу) при 79 ° F (26 ° C) [5] и
  • Концентрированный спирт (96% спирта по весу) может загореться при температуре 63 ° F (17 ° C). [5] .
.

Смотрите также

 
 
© 2020 Спортивный клуб "Канку". Все права защищены.